PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0054s0160.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 548aa    MW: 60967.1 Da    PI: 6.1624
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0054s0160.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS454.94.9e-1391775471374
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                             l+++L++cA+avs++dl +aq l+ +l++++s +g+p+qRl ay++e+L arla+s+s+++kal+++e +   s+e l+++++++ev
  SapurV1A.0054s0160.4.p 177 LKQVLIACAKAVSDNDLLMAQCLMDKLRQMVSVSGEPIQRLGAYMLEGLVARLASSGSSICKALRCKEPA---SAEMLSYMHILYEV 260
                             5799*****************************************************************9...9************* PP

                    GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeel 172
                             + ++kf+++ aN aI ea++ e+rvHiiDf+i+qG QW++L+qa+a+Rp+gpp++RiTg+++++s   +   l  +g+rL+k+Ae++
  SapurV1A.0054s0160.4.p 261 CAYFKFGYMSANGAIAEAMKDENRVHIIDFQIGQGSQWISLIQAFAARPGGPPHIRITGIDDSTSAyaRGGGLGIVGKRLSKLAESF 347
                             **************************************************************998899999**************** PP

                    GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfle 259
                             +vpfef++ ++ +  ++++e+L v++gEalaVn+++ lh+++desvs++++rd+vL+lvkslsPkvv++veqe+++n++ F+ rfle
  SapurV1A.0054s0160.4.p 348 KVPFEFHA-ASMSGCEVRIESLGVRRGEALAVNFAFVLHHMPDESVSTQNHRDRVLRLVKSLSPKVVTLVEQESNTNTAAFFPRFLE 433
                             ********.89999************************************************************************* PP

                    GRAS 260 aleyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                             +l+yy+a+f+s++++lpr+++eri+vE+++l+r++vn++aceg+er+erhe l+kWr+r+++aGF+p+pls+ +++++k+ll+++++
  SapurV1A.0054s0160.4.p 434 TLNYYTAMFESIDVTLPRDHKERINVEQHCLARDVVNIIACEGTERVERHELLGKWRSRFTMAGFTPYPLSTLVNATIKTLLENYSD 520
                             **************************************************************************************6 PP

                    GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaWr 374
                             + yr++e++g+l+lgW++r Lv+ +aW+
  SapurV1A.0054s0160.4.p 521 R-YRLQERDGALYLGWMNRDLVASCAWK 547
                             6.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.494151528IPR005202Transcription factor GRAS
PfamPF035141.7E-136177547IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MQASKQLRGS GMSSRFLYQQ MQEVEAYCKP QFRTLDHQIY SSGRTEGTPF TIPNSLEQYC  60
TLESSSANGS YAAYNSPSTV SFSPNGSPMS QQESQSYSLE PLHSPDNATG SPISGSCITD  120
DAHDFRHKLR ELETVMFAPD SDIFDSIENA LESGTNIESL EMDSWRQIMD VISRGDLKQV  180
LIACAKAVSD NDLLMAQCLM DKLRQMVSVS GEPIQRLGAY MLEGLVARLA SSGSSICKAL  240
RCKEPASAEM LSYMHILYEV CAYFKFGYMS ANGAIAEAMK DENRVHIIDF QIGQGSQWIS  300
LIQAFAARPG GPPHIRITGI DDSTSAYARG GGLGIVGKRL SKLAESFKVP FEFHAASMSG  360
CEVRIESLGV RRGEALAVNF AFVLHHMPDE SVSTQNHRDR VLRLVKSLSP KVVTLVEQES  420
NTNTAAFFPR FLETLNYYTA MFESIDVTLP RDHKERINVE QHCLARDVVN IIACEGTERV  480
ERHELLGKWR SRFTMAGFTP YPLSTLVNAT IKTLLENYSD RYRLQERDGA LYLGWMNRDL  540
VASCAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-601795476375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011048955.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_011048956.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLB9IAQ70.0B9IAQ7_POPTR; Uncharacterized protein
STRINGPOPTR_0014s16230.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein